SCOP 1.73: Domain d1r0ah1: 1r0a H:1-123

Lineage for d1r0ah1 (1r0a H:1-123)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 6 [TaxId:10090] [88556] (12 PDB entries)

8. Domain d1r0ah1: 1r0a H:1-123 [104679]
   Other proteins in same PDB: d1r0aa1, d1r0aa2, d1r0ab1, d1r0ah2, d1r0al1, d1r0al2
   complexed with 2da, glc, gol, mg

Details for d1r0ah1

PDB Entry: 1r0a, 2.8 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase covalently tethered to dna template-primer solved to 2.8 angstroms

PDB Compounds: (H:) monoclonal antibody (heavy chain)

SCOP Domain Sequences for d1r0ah1:

Sequence; same for both SEQRES and ATOM records:

>d1r0ah1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]}
qitlkesgpgivqpsqpfrltctfsgfslstsgigvtwirqpsgkglewlatiwwdddnr
ynpslksrltvskdtsnnqaflnmmtvetadtaiyycaqsaitsvtdsamdhwgqgtsvt
vss

Timeline for d1r0ah1:

• d1r0ah1 first appeared in SCOP 1.69
  
• d1r0ah1 appears in SCOP 1.71
  
• d1r0ah1 appears in SCOP 1.75
  
• d1r0ah1 appears in the current release, SCOPe 2.08