Lineage for d1r0aa1 (1r0a A:430-558)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701966Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) (S)
    consists of one domain of this fold
  5. 701967Family c.55.3.1: Ribonuclease H [53099] (4 proteins)
  6. 701998Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)
  7. 701999Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (85 PDB entries)
  8. 702050Domain d1r0aa1: 1r0a A:430-558 [104676]
    Other proteins in same PDB: d1r0aa2, d1r0ab1, d1r0ah1, d1r0ah2, d1r0al1, d1r0al2
    complexed with 2da, glc, gol, mg

Details for d1r0aa1

PDB Entry: 1r0a (more details), 2.8 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase covalently tethered to dna template-primer solved to 2.8 angstroms
PDB Compounds: (A:) reverse transcriptase

SCOP Domain Sequences for d1r0aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0aa1 c.55.3.1 (A:430-558) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagirk

SCOP Domain Coordinates for d1r0aa1:

Click to download the PDB-style file with coordinates for d1r0aa1.
(The format of our PDB-style files is described here.)

Timeline for d1r0aa1: