SCOP 1.71: Domain d1q3xb2: 1q3x B:366-440

Lineage for d1q3xb2 (1q3x B:366-440)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (11 proteins)
   Pfam 00084

6. Protein Mannan-binding lectin serine protease 2 (MASP-2) domains [111409] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [111410] (1 PDB entry)

8. Domain d1q3xb2: 1q3x B:366-440 [104529]
   Other proteins in same PDB: d1q3xa1, d1q3xb1
   complexed with gol, na

Details for d1q3xb2

PDB Entry: 1q3x, 2.23 Å

PDB Description: Crystal structure of the catalytic region of human MASP-2

SCOP Domain Sequences for d1q3xb2:

Sequence, based on SEQRES records:

>d1q3xb2 g.18.1.1 (B:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens)}
cgppddlpsgrveyitgpgvttykaviqysceetfytmkvndgkyvceadgfwtsskgek
slpvcepvcglsart

Sequence, based on observed residues (ATOM records):

>d1q3xb2 g.18.1.1 (B:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens)}
cgppddlpsgrveyitgpgvttykaviqysceetfytmkvndgkyvcgfwtsskgekslp
vcepvcglsart

Timeline for d1q3xb2:

• d1q3xb2 first appeared in SCOP 1.69
  
• d1q3xb2 appears in SCOP 1.73
  
• d1q3xb2 appears in the current release, SCOPe 2.08