SCOP 1.71: Domain d1q3xb1: 1q3x B:445-686

Lineage for d1q3xb1 (1q3x B:445-686)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain [110241] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110242] (1 PDB entry)

8. Domain d1q3xb1: 1q3x B:445-686 [104528]
   Other proteins in same PDB: d1q3xa2, d1q3xb2
   complexed with gol, na

Details for d1q3xb1

PDB Entry: 1q3x, 2.23 Å

PDB Description: Crystal structure of the catalytic region of human MASP-2

SCOP Domain Sequences for d1q3xb1:

Sequence; same for both SEQRES and ATOM records:

>d1q3xb1 b.47.1.2 (B:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens)}
iyggqkakpgdfpwqvlilggttaagallydnwvltaahavyeqkhdasaldirmgtlkr
lsphytqawseavfihegythdagfdndialiklnnkvvinsnitpiclprkeaesfmrt
ddigtasgwgltqrgflarnlmyvdipivdhqkctaayekppyprgsvtanmlcaglesg
gkdscrgdsggalvfldseterwfvggivswgsmncgeagqygvytkvinyipwieniis
df

Timeline for d1q3xb1:

• d1q3xb1 first appeared in SCOP 1.69
  
• d1q3xb1 appears in SCOP 1.73
  
• d1q3xb1 appears in the current release, SCOPe 2.08