![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
![]() | Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) ![]() |
![]() | Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins) Pfam PF00084 |
![]() | Protein Mannan-binding lectin serine protease 2 (MASP-2) domains [111409] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [111410] (2 PDB entries) Uniprot O00187 366-686 |
![]() | Domain d1q3xa2: 1q3x A:366-440 [104527] Other proteins in same PDB: d1q3xa1, d1q3xb1 complexed with gol, na |
PDB Entry: 1q3x (more details), 2.23 Å
SCOPe Domain Sequences for d1q3xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q3xa2 g.18.1.1 (A:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]} cgppddlpsgrveyitgpgvttykaviqysceetfytmkvndgkyvceadgfwtsskgek slpvcepvcglsart
Timeline for d1q3xa2: