Lineage for d1q3xa2 (1q3x A:366-440)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1064241Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 1064242Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 1064243Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 1064483Protein Mannan-binding lectin serine protease 2 (MASP-2) domains [111409] (1 species)
  7. 1064484Species Human (Homo sapiens) [TaxId:9606] [111410] (2 PDB entries)
    Uniprot O00187 366-686
  8. 1064485Domain d1q3xa2: 1q3x A:366-440 [104527]
    Other proteins in same PDB: d1q3xa1, d1q3xb1
    complexed with gol, na

Details for d1q3xa2

PDB Entry: 1q3x (more details), 2.23 Å

PDB Description: Crystal structure of the catalytic region of human MASP-2
PDB Compounds: (A:) Mannan-binding lectin serine protease 2

SCOPe Domain Sequences for d1q3xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q3xa2 g.18.1.1 (A:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]}
cgppddlpsgrveyitgpgvttykaviqysceetfytmkvndgkyvceadgfwtsskgek
slpvcepvcglsart

SCOPe Domain Coordinates for d1q3xa2:

Click to download the PDB-style file with coordinates for d1q3xa2.
(The format of our PDB-style files is described here.)

Timeline for d1q3xa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q3xa1