Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain [110241] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [110242] (2 PDB entries) Uniprot O00187 366-686 |
Domain d1q3xa1: 1q3x A:445-686 [104526] Other proteins in same PDB: d1q3xa2, d1q3xa3, d1q3xb2 complexed with gol, na |
PDB Entry: 1q3x (more details), 2.23 Å
SCOPe Domain Sequences for d1q3xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} iyggqkakpgdfpwqvlilggttaagallydnwvltaahavyeqkhdasaldirmgtlkr lsphytqawseavfihegythdagfdndialiklnnkvvinsnitpiclprkeaesfmrt ddigtasgwgltqrgflarnlmyvdipivdhqkctaayekppyprgsvtanmlcaglesg gkdscrgdsggalvfldseterwfvggivswgsmncgeagqygvytkvinyipwieniis df
Timeline for d1q3xa1: