Lineage for d1q2qa_ (1q2q A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949301Protein AMPC beta-Lactamase, class C [56618] (4 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 1949330Species Enterobacter cloacae, P99, cephalosporinase [TaxId:550] [56620] (9 PDB entries)
    Uniprot P05364 22-380 ! Uniprot P05364 22-381
  8. 1949333Domain d1q2qa_: 1q2q A: [104502]
    complexed with gol, wy2

Details for d1q2qa_

PDB Entry: 1q2q (more details), 1.4 Å

PDB Description: enterobacter cloacae gc1 class c beta-lactamase complexed with penem way185229
PDB Compounds: (A:) class C beta-lactamase

SCOPe Domain Sequences for d1q2qa_:

Sequence, based on SEQRES records: (download)

>d1q2qa_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase [TaxId: 550]}
pvsekqlaevvantvtplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
lgsisktftgvlggdaiargeislddpvtrywpqltgkqwqgirmldlatytagglplqv
pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
lkldhtwinvpkaeeahyawgyrdgkavravrvspgmldaqaygvktnvqdmanwvmanm
apenvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpv
aevnppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhile
alq

Sequence, based on observed residues (ATOM records): (download)

>d1q2qa_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase [TaxId: 550]}
pvsekqlaevvantvtplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
lgsisktftgvlggdaiargeislddpvtrywpqltgkqwqgirmldlatytagglplqv
pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
lkldhtwinvpkaeeahyawgyrdgkavravrmldaqaygvktnvqdmanwvmanmapen
vadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvaevn
ppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhilealq

SCOPe Domain Coordinates for d1q2qa_:

Click to download the PDB-style file with coordinates for d1q2qa_.
(The format of our PDB-style files is described here.)

Timeline for d1q2qa_: