SCOPe 2.08: Domain d1q1va1: 1q1v A:309-375

Lineage for d1q1va1 (1q1v A:309-375)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.159: Another 3-helical bundle [81602] (5 superfamilies)
   topologically similar to the DNA/RNA-binding bundles; distinct packing

4. Superfamily a.159.4: DEK C-terminal domain [109715] (1 family)
   automatically mapped to Pfam PF08766

5. Family a.159.4.1: DEK C-terminal domain [109716] (1 protein)

6. Protein DEK C-terminal domain [109717] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109718] (1 PDB entry)
   Uniprot P35659 309-375

8. Domain d1q1va1: 1q1v A:309-375 [104479]
   Other proteins in same PDB: d1q1va2

Details for d1q1va1

PDB Entry: 1q1v

PDB Description: structure of the oncoprotein dek: a putative dna-binding domain related to the winged helix motif

PDB Compounds: (A:) DEK protein

SCOPe Domain Sequences for d1q1va1:

Sequence; same for both SEQRES and ATOM records:

>d1q1va1 a.159.4.1 (A:309-375) DEK C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
deplikklkkpptdeelketikkllasanleevtmkqickkvyenyptydlterkdfikt
tvkelis

Timeline for d1q1va1:

• d1q1va1 first appeared in SCOP 1.69, called d1q1va_
  
• d1q1va1 appears in SCOPe 2.07