Class a: All alpha proteins [46456] (290 folds) |
Fold a.159: Another 3-helical bundle [81602] (5 superfamilies) topologically similar to the DNA/RNA-binding bundles; distinct packing |
Superfamily a.159.4: DEK C-terminal domain [109715] (1 family) automatically mapped to Pfam PF08766 |
Family a.159.4.1: DEK C-terminal domain [109716] (1 protein) |
Protein DEK C-terminal domain [109717] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [109718] (1 PDB entry) Uniprot P35659 309-375 |
Domain d1q1va1: 1q1v A:309-375 [104479] Other proteins in same PDB: d1q1va2 |
PDB Entry: 1q1v (more details)
SCOPe Domain Sequences for d1q1va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q1va1 a.159.4.1 (A:309-375) DEK C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} deplikklkkpptdeelketikkllasanleevtmkqickkvyenyptydlterkdfikt tvkelis
Timeline for d1q1va1: