Lineage for d1q0la3 (1q0l A:126-274)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506899Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 506900Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 507141Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 507142Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69770] (2 species)
  7. 507143Species Escherichia coli [TaxId:562] [69771] (10 PDB entries)
  8. 507162Domain d1q0la3: 1q0l A:126-274 [104457]
    Other proteins in same PDB: d1q0la1, d1q0la2

Details for d1q0la3

PDB Entry: 1q0l (more details), 2.65 Å

PDB Description: crystal structure of dxr in complex with fosmidomycin

SCOP Domain Sequences for d1q0la3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0la3 d.81.1.3 (A:126-274) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli}
eslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvsilltg
sggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfnasasq
mevlihpqsvihsmvryqdgsvlaqlgep

SCOP Domain Coordinates for d1q0la3:

Click to download the PDB-style file with coordinates for d1q0la3.
(The format of our PDB-style files is described here.)

Timeline for d1q0la3: