Lineage for d1pw3a_ (1pw3 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512286Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 1512290Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88535] (4 PDB entries)
    SQ NA # Bence-Jones protein JTO ! Uniprot P06317 # Ig lambda chain V-VI region SUT
  8. 1512295Domain d1pw3a_: 1pw3 A: [104335]
    complexed with cd

Details for d1pw3a_

PDB Entry: 1pw3 (more details), 1.9 Å

PDB Description: crystal structure of jtor68s
PDB Compounds: (A:) immunoglobulin lambda chain variable region

SCOPe Domain Sequences for d1pw3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pw3a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
nfmlnqphsvsespgktvtisctrssgnidsnyvqwyqqrpgsapitviyednqrpsgvp
drfagsidsssnsasltisglktedeadyycqsydarnvvfgggtrltvlg

SCOPe Domain Coordinates for d1pw3a_:

Click to download the PDB-style file with coordinates for d1pw3a_.
(The format of our PDB-style files is described here.)

Timeline for d1pw3a_: