Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Immunomodulatory protein m144, alpha-1 and alpha-2 domains [110841] (1 species) |
Species Murine cytomegalovirus [TaxId:10366] [110842] (2 PDB entries) Uniprot Q69G19 27-263 # 95% sequence identity |
Domain d1pqza2: 1pqz A:5-143 [104298] Other proteins in same PDB: d1pqza1, d1pqzb_ |
PDB Entry: 1pqz (more details), 2.1 Å
SCOPe Domain Sequences for d1pqza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pqza2 d.19.1.1 (A:5-143) Immunomodulatory protein m144, alpha-1 and alpha-2 domains {Murine cytomegalovirus [TaxId: 10366]} gsesglryaytlvvdgtantarcfgtghvdgeafvgysnnkthgigrwvnashveeenke fvrqckelqaeldkmqnnsavigvktvqldvgctskiekhyaydgneteddtatsasera rdcqkklteyrklvlasav
Timeline for d1pqza2: