Lineage for d1pqza2 (1pqz A:5-143)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2183523Protein Immunomodulatory protein m144, alpha-1 and alpha-2 domains [110841] (1 species)
  7. 2183524Species Murine cytomegalovirus [TaxId:10366] [110842] (2 PDB entries)
    Uniprot Q69G19 27-263 # 95% sequence identity
  8. 2183526Domain d1pqza2: 1pqz A:5-143 [104298]
    Other proteins in same PDB: d1pqza1, d1pqzb_

Details for d1pqza2

PDB Entry: 1pqz (more details), 2.1 Å

PDB Description: murine cytomegalovirus immunomodulatory protein m144
PDB Compounds: (A:) mcmv m144

SCOPe Domain Sequences for d1pqza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pqza2 d.19.1.1 (A:5-143) Immunomodulatory protein m144, alpha-1 and alpha-2 domains {Murine cytomegalovirus [TaxId: 10366]}
gsesglryaytlvvdgtantarcfgtghvdgeafvgysnnkthgigrwvnashveeenke
fvrqckelqaeldkmqnnsavigvktvqldvgctskiekhyaydgneteddtatsasera
rdcqkklteyrklvlasav

SCOPe Domain Coordinates for d1pqza2:

Click to download the PDB-style file with coordinates for d1pqza2.
(The format of our PDB-style files is described here.)

Timeline for d1pqza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pqza1
View in 3D
Domains from other chains:
(mouse over for more information)
d1pqzb_