SCOP 1.69: Domain d1pqza2: 1pqz A:5-143

Lineage for d1pqza2 (1pqz A:5-143)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Immunomodulatory protein m144, alpha-1 and alpha-2 domains [110841] (1 species)

7. Species Murine cytomegalovirus [TaxId:10366] [110842] (1 PDB entry)

8. Domain d1pqza2: 1pqz A:5-143 [104298]
   Other proteins in same PDB: d1pqza1, d1pqzb_

Details for d1pqza2

PDB Entry: 1pqz, 2.1 Å

PDB Description: murine cytomegalovirus immunomodulatory protein m144

SCOP Domain Sequences for d1pqza2:

Sequence; same for both SEQRES and ATOM records:

>d1pqza2 d.19.1.1 (A:5-143) Immunomodulatory protein m144, alpha-1 and alpha-2 domains {Murine cytomegalovirus}
gsesglryaytlvvdgtantarcfgtghvdgeafvgysnnkthgigrwvnashveeenke
fvrqckelqaeldkmqnnsavigvktvqldvgctskiekhyaydgneteddtatsasera
rdcqkklteyrklvlasav

Timeline for d1pqza2:

• d1pqza2 is new in SCOP 1.69
  
• d1pqza2 appears in SCOP 1.71
  
• d1pqza2 appears in the current release, SCOPe 2.07