SCOP 1.73: Domain d1pqza1: 1pqz A:144-242

Lineage for d1pqza1 (1pqz A:144-242)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunomodulatory protein m144, alpha-3 domain [110048] (1 species)

7. Species Murine cytomegalovirus [TaxId:10366] [110049] (1 PDB entry)

8. Domain d1pqza1: 1pqz A:144-242 [104297]
   Other proteins in same PDB: d1pqza2, d1pqzb_

Details for d1pqza1

PDB Entry: 1pqz, 2.1 Å

PDB Description: murine cytomegalovirus immunomodulatory protein m144

PDB Compounds: (A:) mcmv m144

SCOP Domain Sequences for d1pqza1:

Sequence; same for both SEQRES and ATOM records:

>d1pqza1 b.1.1.2 (A:144-242) Immunomodulatory protein m144, alpha-3 domain {Murine cytomegalovirus [TaxId: 10366]}
spqleverrssgreggmrlrcfardyypadleirwwkddggggalpqtskqhhdplpsgq
glyqkhidvyvdgglehvyscrvkgiatglelqivrwkg

Timeline for d1pqza1:

• d1pqza1 first appeared in SCOP 1.69
  
• d1pqza1 appears in SCOP 1.71
  
• d1pqza1 appears in SCOP 1.75
  
• d1pqza1 appears in the current release, SCOPe 2.08