SCOPe 2.06: Domain d1pqud2: 1pqu D:134-357

Lineage for d1pqud2 (1pqu D:134-357)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)

7. Species Haemophilus influenzae [TaxId:727] [103103] (12 PDB entries)
   Uniprot P44801

8. Domain d1pqud2: 1pqu D:134-357 [104295]
   Other proteins in same PDB: d1pqua1, d1pqub1, d1pquc1, d1pqud1
   complexed with cac, cys, nap; mutant

Details for d1pqud2

PDB Entry: 1pqu, 1.92 Å

PDB Description: crystal structure of the h277n mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with nadp, s-methyl cysteine sulfoxide and cacodylate

PDB Compounds: (D:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d1pqud2:

Sequence; same for both SEQRES and ATOM records:

>d1pqud2 d.81.1.1 (D:134-357) Aspartate beta-semialdehyde dehydrogenase {Haemophilus influenzae [TaxId: 727]}
gnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkd
passildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkeewkgyaetnk
ilglsdnpipvdglcvrigalrcnsqaftiklkkdlpleeieqiiashnewvkvipndke
itlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwg

Timeline for d1pqud2:

• d1pqud2 first appeared in SCOP 1.69
  
• d1pqud2 appears in SCOPe 2.05
  
• d1pqud2 appears in SCOPe 2.07
  
• d1pqud2 appears in the current release, SCOPe 2.08