SCOPe 2.07: Domain d1ppva_: 1ppv A:

Lineage for d1ppva_ (1ppv A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.2: IPP isomerase-like [64369] (4 proteins)

6. Protein Isopentenyl diphosphate isomerase [64370] (2 species)

7. Species Escherichia coli [TaxId:562] [64371] (18 PDB entries)
   Uniprot Q46822

8. Domain d1ppva_: 1ppv A: [104282]
   Other proteins in same PDB: d1ppvb2
   complexed with bhi, mg, mn

Details for d1ppva_

PDB Entry: 1ppv, 1.7 Å

PDB Description: isopentenylpyrophosphate-dimethylallylpyrophosphate isomerase in complex with the bromohydrine of ipp

PDB Compounds: (A:) Isopentenyl-diphosphate delta-isomerase

SCOPe Domain Sequences for d1ppva_:

Sequence; same for both SEQRES and ATOM records:

>d1ppva_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaft

Timeline for d1ppva_:

• d1ppva_ first appeared in SCOP 1.69
  
• d1ppva_ appears in SCOPe 2.06
  
• d1ppva_ appears in the current release, SCOPe 2.08