Lineage for d1ppjp2 (1ppj P:15-260)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887002Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 887003Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 887009Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (2 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 887021Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
    also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits
  7. 887039Species Cow (Bos taurus) [TaxId:9913] [81638] (17 PDB entries)
    Uniprot P00157
  8. 887041Domain d1ppjp2: 1ppj P:15-260 [104272]
    Other proteins in same PDB: d1ppja1, d1ppja2, d1ppjb1, d1ppjb2, d1ppjc1, d1ppjd1, d1ppjd2, d1ppje1, d1ppje2, d1ppjf_, d1ppjg_, d1ppjh_, d1ppji_, d1ppjj_, d1ppjn1, d1ppjn2, d1ppjo1, d1ppjo2, d1ppjp1, d1ppjq1, d1ppjq2, d1ppjr1, d1ppjr2, d1ppjs_, d1ppjt_, d1ppju_, d1ppjv_, d1ppjw_
    complexed with any, azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma

Details for d1ppjp2

PDB Entry: 1ppj (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin and antimycin
PDB Compounds: (P:) cytochrome b

SCOP Domain Sequences for d1ppjp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ppjp2 f.21.1.2 (P:15-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
nnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtttafssvthicrdvn
ygwiirymhangasmfficlymhvgrglyygsytfletwnigvillltvmatafmgyvlp
wgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffafhfilpfiimaiam
vhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalmllvlfapdllgdpd
nytpan

SCOP Domain Coordinates for d1ppjp2:

Click to download the PDB-style file with coordinates for d1ppjp2.
(The format of our PDB-style files is described here.)

Timeline for d1ppjp2: