Lineage for d1ppje1 (1ppj E:70-196)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309647Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1309648Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1309649Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 1309672Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (3 species)
  7. 1309688Species Cow (Bos taurus) [TaxId:9913] [50025] (18 PDB entries)
  8. 1309692Domain d1ppje1: 1ppj E:70-196 [104260]
    Other proteins in same PDB: d1ppja1, d1ppja2, d1ppjb1, d1ppjb2, d1ppjc1, d1ppjc2, d1ppjd1, d1ppjd2, d1ppje2, d1ppjf_, d1ppjg_, d1ppjh_, d1ppji_, d1ppjj_, d1ppjn1, d1ppjn2, d1ppjo1, d1ppjo2, d1ppjp1, d1ppjp2, d1ppjq1, d1ppjq2, d1ppjr2, d1ppjs_, d1ppjt_, d1ppju_, d1ppjv_, d1ppjw_
    complexed with any, azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma

Details for d1ppje1

PDB Entry: 1ppj (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin and antimycin
PDB Compounds: (E:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d1ppje1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ppje1 b.33.1.1 (E:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

SCOPe Domain Coordinates for d1ppje1:

Click to download the PDB-style file with coordinates for d1ppje1.
(The format of our PDB-style files is described here.)

Timeline for d1ppje1: