Lineage for d1ppjc1 (1ppj C:261-379)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 888181Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 888182Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) (S)
  5. 888183Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 888184Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. 888202Species Cow (Bos taurus) [TaxId:9913] [81643] (17 PDB entries)
    Uniprot P00157
  8. 888203Domain d1ppjc1: 1ppj C:261-379 [104256]
    Other proteins in same PDB: d1ppja1, d1ppja2, d1ppjb1, d1ppjb2, d1ppjc2, d1ppjd1, d1ppjd2, d1ppje1, d1ppje2, d1ppjf_, d1ppjg_, d1ppjh_, d1ppji_, d1ppjj_, d1ppjn1, d1ppjn2, d1ppjo1, d1ppjo2, d1ppjp2, d1ppjq1, d1ppjq2, d1ppjr1, d1ppjr2, d1ppjs_, d1ppjt_, d1ppju_, d1ppjv_, d1ppjw_

Details for d1ppjc1

PDB Entry: 1ppj (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin and antimycin
PDB Compounds: (C:) cytochrome b

SCOP Domain Sequences for d1ppjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ppjc1 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw

SCOP Domain Coordinates for d1ppjc1:

Click to download the PDB-style file with coordinates for d1ppjc1.
(The format of our PDB-style files is described here.)

Timeline for d1ppjc1: