Lineage for d1pp9v_ (1pp9 V:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 615383Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily)
    not a true fold
  4. 615384Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families) (S)
    not a true superfamily
  5. 615399Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (1 protein)
    beta-hairpin and a short alpha-helix bound to the core subunits
  6. 615400Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species)
  7. 615401Species Cow (Bos taurus) [TaxId:9913] [90079] (9 PDB entries)
    there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop
  8. 615405Domain d1pp9v_: 1pp9 V: [104250]
    Other proteins in same PDB: d1pp9a1, d1pp9a2, d1pp9b1, d1pp9b2, d1pp9c1, d1pp9c2, d1pp9d1, d1pp9d2, d1pp9e1, d1pp9e2, d1pp9f_, d1pp9g_, d1pp9h_, d1pp9j_, d1pp9n1, d1pp9n2, d1pp9o1, d1pp9o2, d1pp9p1, d1pp9p2, d1pp9q1, d1pp9q2, d1pp9r1, d1pp9r2, d1pp9s_, d1pp9t_, d1pp9u_, d1pp9w_
    complexed with azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma, uq

Details for d1pp9v_

PDB Entry: 1pp9 (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound

SCOP Domain Sequences for d1pp9v_:

Sequence, based on SEQRES records: (download)

>d1pp9v_ d.184.1.3 (V:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus)}
aavpatsespvldlkrsvlcreslrgqaagrplvasvslnvpasvry

Sequence, based on observed residues (ATOM records): (download)

>d1pp9v_ d.184.1.3 (V:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus)}
aavpatsespvsvlcreslrgqaagrplvasvslnvpasvry

SCOP Domain Coordinates for d1pp9v_:

Click to download the PDB-style file with coordinates for d1pp9v_.
(The format of our PDB-style files is described here.)

Timeline for d1pp9v_: