Lineage for d1pp9s_ (1pp9 S:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 520521Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 520522Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
  5. 520523Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (1 protein)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 520524Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)
  7. 520535Species Cow (Bos taurus) [TaxId:9913] [81519] (12 PDB entries)
  8. 520542Domain d1pp9s_: 1pp9 S: [104247]
    Other proteins in same PDB: d1pp9a1, d1pp9a2, d1pp9b1, d1pp9b2, d1pp9c1, d1pp9c2, d1pp9d1, d1pp9d2, d1pp9e1, d1pp9e2, d1pp9g_, d1pp9h_, d1pp9i_, d1pp9j_, d1pp9n1, d1pp9n2, d1pp9o1, d1pp9o2, d1pp9p1, d1pp9p2, d1pp9q1, d1pp9q2, d1pp9r1, d1pp9r2, d1pp9t_, d1pp9u_, d1pp9v_, d1pp9w_

Details for d1pp9s_

PDB Entry: 1pp9 (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound

SCOP Domain Sequences for d1pp9s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pp9s_ f.27.1.1 (S:) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
wlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikraldlsmr
qqilpkeqwtkyeedksylepylkevirerkereewakk

SCOP Domain Coordinates for d1pp9s_:

Click to download the PDB-style file with coordinates for d1pp9s_.
(The format of our PDB-style files is described here.)

Timeline for d1pp9s_: