Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family) |
Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins) |
Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [81497] (12 PDB entries) Uniprot P13272; precursor of chains I,E and V,R |
Domain d1pp9r2: 1pp9 R:1-69 [104246] Other proteins in same PDB: d1pp9a1, d1pp9a2, d1pp9b1, d1pp9b2, d1pp9c1, d1pp9c2, d1pp9d1, d1pp9d2, d1pp9e1, d1pp9f_, d1pp9g_, d1pp9h_, d1pp9i_, d1pp9j_, d1pp9n1, d1pp9n2, d1pp9o1, d1pp9o2, d1pp9p1, d1pp9p2, d1pp9q1, d1pp9q2, d1pp9r1, d1pp9s_, d1pp9t_, d1pp9u_, d1pp9v_, d1pp9w_ complexed with azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma, uq |
PDB Entry: 1pp9 (more details), 2.1 Å
SCOPe Domain Sequences for d1pp9r2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pp9r2 f.23.12.1 (R:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]} shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs smsasadvl
Timeline for d1pp9r2:
View in 3D Domains from other chains: (mouse over for more information) d1pp9a1, d1pp9a2, d1pp9b1, d1pp9b2, d1pp9c1, d1pp9c2, d1pp9d1, d1pp9d2, d1pp9e1, d1pp9e2, d1pp9f_, d1pp9g_, d1pp9h_, d1pp9i_, d1pp9j_, d1pp9n1, d1pp9n2, d1pp9o1, d1pp9o2, d1pp9p1, d1pp9p2, d1pp9q1, d1pp9q2, d1pp9s_, d1pp9t_, d1pp9u_, d1pp9v_, d1pp9w_ |