![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
![]() | Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) ![]() Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
![]() | Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
![]() | Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species) also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81638] (18 PDB entries) Uniprot P00157 |
![]() | Domain d1pp9p2: 1pp9 P:15-260 [104242] Other proteins in same PDB: d1pp9a1, d1pp9a2, d1pp9b1, d1pp9b2, d1pp9c1, d1pp9d1, d1pp9d2, d1pp9e1, d1pp9e2, d1pp9f_, d1pp9g_, d1pp9h_, d1pp9i_, d1pp9j_, d1pp9n1, d1pp9n2, d1pp9o1, d1pp9o2, d1pp9p1, d1pp9q1, d1pp9q2, d1pp9r1, d1pp9r2, d1pp9s_, d1pp9t_, d1pp9u_, d1pp9v_, d1pp9w_ complexed with azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma, uq |
PDB Entry: 1pp9 (more details), 2.1 Å
SCOPe Domain Sequences for d1pp9p2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pp9p2 f.21.1.2 (P:15-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} nnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtttafssvthicrdvn ygwiirymhangasmfficlymhvgrglyygsytfletwnigvillltvmatafmgyvlp wgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffafhfilpfiimaiam vhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalmllvlfapdllgdpd nytpan
Timeline for d1pp9p2:
![]() Domains from other chains: (mouse over for more information) d1pp9a1, d1pp9a2, d1pp9b1, d1pp9b2, d1pp9c1, d1pp9c2, d1pp9d1, d1pp9d2, d1pp9e1, d1pp9e2, d1pp9f_, d1pp9g_, d1pp9h_, d1pp9i_, d1pp9j_, d1pp9n1, d1pp9n2, d1pp9o1, d1pp9o2, d1pp9q1, d1pp9q2, d1pp9r1, d1pp9r2, d1pp9s_, d1pp9t_, d1pp9u_, d1pp9v_, d1pp9w_ |