![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.184: Non-globular alpha+beta subunits of globular proteins [56567] (1 superfamily) not a true fold |
![]() | Superfamily d.184.1: Non-globular alpha+beta subunits of globular proteins [56568] (3 families) ![]() not a true superfamily |
![]() | Family d.184.1.3: Ubiquinol-cytochrome c reductase 8 kDa protein [90077] (1 protein) beta-hairpin and a short alpha-helix bound to the core subunits |
![]() | Protein Ubiquinol-cytochrome c reductase 8 kDa protein [90078] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [90079] (9 PDB entries) there are other PDB entries with lower resolution structures of the Ubiquinol-cytochrome c reductase complex, in which this subunit has incomplete and probably mistraced structure that is not classified in scop |
![]() | Domain d1pp9i_: 1pp9 I: [104235] Other proteins in same PDB: d1pp9a1, d1pp9a2, d1pp9b1, d1pp9b2, d1pp9c1, d1pp9c2, d1pp9d1, d1pp9d2, d1pp9e1, d1pp9e2, d1pp9f_, d1pp9g_, d1pp9h_, d1pp9j_, d1pp9n1, d1pp9n2, d1pp9o1, d1pp9o2, d1pp9p1, d1pp9p2, d1pp9q1, d1pp9q2, d1pp9r1, d1pp9r2, d1pp9s_, d1pp9t_, d1pp9u_, d1pp9w_ |
PDB Entry: 1pp9 (more details), 2.1 Å
SCOP Domain Sequences for d1pp9i_:
Sequence, based on SEQRES records: (download)
>d1pp9i_ d.184.1.3 (I:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus)} aavpatsespvldlkrsvlcreslrgqaagrplvasvslnvpasvry
>d1pp9i_ d.184.1.3 (I:) Ubiquinol-cytochrome c reductase 8 kDa protein {Cow (Bos taurus)} aavpatsespvsvlcreslrgqaagrplvasvslnvpasvry
Timeline for d1pp9i_:
![]() Domains from other chains: (mouse over for more information) d1pp9a1, d1pp9a2, d1pp9b1, d1pp9b2, d1pp9c1, d1pp9c2, d1pp9d1, d1pp9d2, d1pp9e1, d1pp9e2, d1pp9f_, d1pp9g_, d1pp9h_, d1pp9j_, d1pp9n1, d1pp9n2, d1pp9o1, d1pp9o2, d1pp9p1, d1pp9p2, d1pp9q1, d1pp9q2, d1pp9r1, d1pp9r2, d1pp9s_, d1pp9t_, d1pp9u_, d1pp9v_, d1pp9w_ |