Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) location - intermembrane side of the bc1 complex |
Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (1 protein) "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1 |
Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [81526] (18 PDB entries) Uniprot P00126 |
Domain d1pp9h_: 1pp9 H: [104234] Other proteins in same PDB: d1pp9a1, d1pp9a2, d1pp9b1, d1pp9b2, d1pp9c1, d1pp9c2, d1pp9d1, d1pp9d2, d1pp9e1, d1pp9e2, d1pp9f_, d1pp9g_, d1pp9i_, d1pp9j_, d1pp9n1, d1pp9n2, d1pp9o1, d1pp9o2, d1pp9p1, d1pp9p2, d1pp9q1, d1pp9q2, d1pp9r1, d1pp9r2, d1pp9s_, d1pp9t_, d1pp9v_, d1pp9w_ |
PDB Entry: 1pp9 (more details), 2.1 Å
SCOP Domain Sequences for d1pp9h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pp9h_ f.28.1.1 (H:) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahk lfnslk
Timeline for d1pp9h_:
View in 3D Domains from other chains: (mouse over for more information) d1pp9a1, d1pp9a2, d1pp9b1, d1pp9b2, d1pp9c1, d1pp9c2, d1pp9d1, d1pp9d2, d1pp9e1, d1pp9e2, d1pp9f_, d1pp9g_, d1pp9i_, d1pp9j_, d1pp9n1, d1pp9n2, d1pp9o1, d1pp9o2, d1pp9p1, d1pp9p2, d1pp9q1, d1pp9q2, d1pp9r1, d1pp9r2, d1pp9s_, d1pp9t_, d1pp9u_, d1pp9v_, d1pp9w_ |