Details for d1pp9g_

PDB Entry: 1pp9 (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound

SCOP Domain Sequences for d1pp9g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pp9g_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpa

SCOP Domain Coordinates for d1pp9g_:

Click to download the PDB-style file with coordinates for d1pp9g_.
(The format of our PDB-style files is described here.)

Timeline for d1pp9g_: