SCOPe 2.03: Domain d1pp9e2: 1pp9 E:1-69

Lineage for d1pp9e2 (1pp9 E:1-69)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family)

5. Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)

6. Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81497] (17 PDB entries)
   Uniprot P13272; precursor of chains I,E and V,R

8. Domain d1pp9e2: 1pp9 E:1-69 [104231]
   Other proteins in same PDB: d1pp9a1, d1pp9a2, d1pp9b1, d1pp9b2, d1pp9c1, d1pp9c2, d1pp9d1, d1pp9d2, d1pp9e1, d1pp9f_, d1pp9g_, d1pp9h_, d1pp9i_, d1pp9j_, d1pp9n1, d1pp9n2, d1pp9o1, d1pp9o2, d1pp9p1, d1pp9p2, d1pp9q1, d1pp9q2, d1pp9r1, d1pp9s_, d1pp9t_, d1pp9u_, d1pp9v_, d1pp9w_
   complexed with azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma, uq

Details for d1pp9e2

PDB Entry: 1pp9, 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound

PDB Compounds: (E:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d1pp9e2:

Sequence; same for both SEQRES and ATOM records:

>d1pp9e2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

Timeline for d1pp9e2:

• d1pp9e2 first appeared in SCOP 1.69
  
• d1pp9e2 appears in SCOPe 2.02
  
• d1pp9e2 appears in SCOPe 2.04
  
• d1pp9e2 appears in the current release, SCOPe 2.08