Lineage for d1pp9e2 (1pp9 E:1-69)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 519895Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 520129Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family) (S)
  5. 520130Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 520131Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)
  7. 520142Species Cow (Bos taurus) [TaxId:9913] [81497] (12 PDB entries)
  8. 520148Domain d1pp9e2: 1pp9 E:1-69 [104231]
    Other proteins in same PDB: d1pp9a1, d1pp9a2, d1pp9b1, d1pp9b2, d1pp9c1, d1pp9c2, d1pp9d1, d1pp9d2, d1pp9e1, d1pp9f_, d1pp9g_, d1pp9h_, d1pp9i_, d1pp9j_, d1pp9n1, d1pp9n2, d1pp9o1, d1pp9o2, d1pp9p1, d1pp9p2, d1pp9q1, d1pp9q2, d1pp9r1, d1pp9s_, d1pp9t_, d1pp9u_, d1pp9v_, d1pp9w_

Details for d1pp9e2

PDB Entry: 1pp9 (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound
PDB Compounds: (E:)

SCOP Domain Sequences for d1pp9e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pp9e2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus)}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

SCOP Domain Coordinates for d1pp9e2:

Click to download the PDB-style file with coordinates for d1pp9e2.
(The format of our PDB-style files is described here.)

Timeline for d1pp9e2: