Lineage for d1pp9d1 (1pp9 D:1-195)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304893Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)
  6. 2304894Protein Cytochrome bc1 domain [46677] (4 species)
  7. 2304910Species Cow (Bos taurus) [TaxId:9913] [46678] (19 PDB entries)
    Uniprot P00125
  8. 2304916Domain d1pp9d1: 1pp9 D:1-195 [104228]
    Other proteins in same PDB: d1pp9a1, d1pp9a2, d1pp9b1, d1pp9b2, d1pp9c1, d1pp9c2, d1pp9d2, d1pp9e1, d1pp9e2, d1pp9f_, d1pp9g_, d1pp9h_, d1pp9i_, d1pp9j_, d1pp9n1, d1pp9n2, d1pp9o1, d1pp9o2, d1pp9p1, d1pp9p2, d1pp9q2, d1pp9r1, d1pp9r2, d1pp9s_, d1pp9t_, d1pp9u_, d1pp9v_, d1pp9w_
    complexed with azi, cdl, fes, gol, hec, hem, jzr, pee, po4, sma, uq

Details for d1pp9d1

PDB Entry: 1pp9 (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound
PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d1pp9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pp9d1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

SCOPe Domain Coordinates for d1pp9d1:

Click to download the PDB-style file with coordinates for d1pp9d1.
(The format of our PDB-style files is described here.)

Timeline for d1pp9d1: