Lineage for d1pp9c2 (1pp9 C:15-260)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745424Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 745425Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 745431Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (2 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 745443Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
    also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits
  7. 745455Species Cow (Bos taurus) [TaxId:9913] [81638] (17 PDB entries)
  8. 745458Domain d1pp9c2: 1pp9 C:15-260 [104227]
    Other proteins in same PDB: d1pp9a1, d1pp9a2, d1pp9b1, d1pp9b2, d1pp9c1, d1pp9d1, d1pp9d2, d1pp9e1, d1pp9e2, d1pp9f_, d1pp9g_, d1pp9h_, d1pp9i_, d1pp9j_, d1pp9n1, d1pp9n2, d1pp9o1, d1pp9o2, d1pp9p1, d1pp9q1, d1pp9q2, d1pp9r1, d1pp9r2, d1pp9s_, d1pp9t_, d1pp9u_, d1pp9v_, d1pp9w_

Details for d1pp9c2

PDB Entry: 1pp9 (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound
PDB Compounds: (C:) cytochrome b

SCOP Domain Sequences for d1pp9c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pp9c2 f.21.1.2 (C:15-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
nnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtttafssvthicrdvn
ygwiirymhangasmfficlymhvgrglyygsytfletwnigvillltvmatafmgyvlp
wgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffafhfilpfiimaiam
vhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalmllvlfapdllgdpd
nytpan

SCOP Domain Coordinates for d1pp9c2:

Click to download the PDB-style file with coordinates for d1pp9c2.
(The format of our PDB-style files is described here.)

Timeline for d1pp9c2: