Lineage for d1pl2b2 (1pl2 B:2-80)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584500Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 584501Superfamily c.47.1: Thioredoxin-like [52833] (16 families) (S)
  5. 584721Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 584732Protein Class alpha GST [81360] (8 species)
  7. 584742Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (15 PDB entries)
  8. 584750Domain d1pl2b2: 1pl2 B:2-80 [104185]
    Other proteins in same PDB: d1pl2a1, d1pl2b1
    complexed with aby, cl; mutant

Details for d1pl2b2

PDB Entry: 1pl2 (more details), 1.8 Å

PDB Description: crystal structure of human glutathione transferase (gst) a1-1 t68e mutant in complex with decarboxy-glutathione

SCOP Domain Sequences for d1pl2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pl2b2 c.47.1.5 (B:2-80) Class alpha GST {Human (Homo sapiens), (a1-1)}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqerailnyiaskyn

SCOP Domain Coordinates for d1pl2b2:

Click to download the PDB-style file with coordinates for d1pl2b2.
(The format of our PDB-style files is described here.)

Timeline for d1pl2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pl2b1