SCOP 1.69: Domain d1pl2b1: 1pl2 B:81-222

Lineage for d1pl2b1 (1pl2 B:81-222)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (15 PDB entries)

8. Domain d1pl2b1: 1pl2 B:81-222 [104184]
   Other proteins in same PDB: d1pl2a2, d1pl2b2

Details for d1pl2b1

PDB Entry: 1pl2, 1.8 Å

PDB Description: crystal structure of human glutathione transferase (gst) a1-1 t68e mutant in complex with decarboxy-glutathione

SCOP Domain Sequences for d1pl2b1:

Sequence; same for both SEQRES and ATOM records:

>d1pl2b1 a.45.1.1 (B:81-222) Class alpha GST {Human (Homo sapiens), (a1-1)}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

Timeline for d1pl2b1:

• d1pl2b1 is new in SCOP 1.69
  
• d1pl2b1 appears in SCOP 1.71
  
• d1pl2b1 appears in the current release, SCOPe 2.08