SCOPe 2.03: Domain d1pkwb2: 1pkw B:2-80

Lineage for d1pkwb2 (1pkw B:2-80)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (28 PDB entries)
   Uniprot P08263

8. Domain d1pkwb2: 1pkw B:2-80 [104173]
   Other proteins in same PDB: d1pkwa1, d1pkwb1
   complexed with gsh, hed

Details for d1pkwb2

PDB Entry: 1pkw, 2 Å

PDB Description: crystal structure of human glutathione transferase (gst) a1-1 in complex with glutathione

PDB Compounds: (B:) glutathione s-transferase a1

SCOPe Domain Sequences for d1pkwb2:

Sequence; same for both SEQRES and ATOM records:

>d1pkwb2 c.47.1.5 (B:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

Timeline for d1pkwb2:

• d1pkwb2 first appeared in SCOP 1.69
  
• d1pkwb2 appears in SCOPe 2.02
  
• d1pkwb2 appears in SCOPe 2.04
  
• d1pkwb2 appears in the current release, SCOPe 2.08