Lineage for d1pkwa2 (1pkw A:2-80)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2132062Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2132073Protein Class alpha GST [81360] (8 species)
  7. 2132086Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (30 PDB entries)
    Uniprot P08263
  8. 2132101Domain d1pkwa2: 1pkw A:2-80 [104171]
    Other proteins in same PDB: d1pkwa1, d1pkwb1
    complexed with gsh, hed

Details for d1pkwa2

PDB Entry: 1pkw (more details), 2 Å

PDB Description: crystal structure of human glutathione transferase (gst) a1-1 in complex with glutathione
PDB Compounds: (A:) glutathione s-transferase a1

SCOPe Domain Sequences for d1pkwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkwa2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

SCOPe Domain Coordinates for d1pkwa2:

Click to download the PDB-style file with coordinates for d1pkwa2.
(The format of our PDB-style files is described here.)

Timeline for d1pkwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pkwa1