Lineage for d1p1aa_ (1p1a A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402618Protein Ubiquitin-like domain of Rad23 homolog B (Hhr23B) [102777] (1 species)
  7. 1402619Species Human (Homo sapiens) [TaxId:9606] [102778] (2 PDB entries)
    Uniprot P54727 1-82
  8. 1402621Domain d1p1aa_: 1p1a A: [104059]

Details for d1p1aa_

PDB Entry: 1p1a (more details)

PDB Description: nmr structure of ubiquitin-like domain of hhr23b
PDB Compounds: (A:) UV excision repair protein RAD23 homolog B

SCOPe Domain Sequences for d1p1aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p1aa_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]}
gshmqvtlktlqqqtfkididpeetvkalkekiesekgkdafpvagqkliyagkilnddt
alkeykideknfvvvmvtkpkavst

SCOPe Domain Coordinates for d1p1aa_:

Click to download the PDB-style file with coordinates for d1p1aa_.
(The format of our PDB-style files is described here.)

Timeline for d1p1aa_: