Lineage for d1ojsa2 (1ojs A:164-331)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 877107Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 877108Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 877109Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 877116Protein Lactate dehydrogenase [56339] (15 species)
  7. 877117Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [111253] (2 PDB entries)
    Uniprot O08349
  8. 877119Domain d1ojsa2: 1ojs A:164-331 [103989]
    Other proteins in same PDB: d1ojsa1
    complexed with na, nad, so4

Details for d1ojsa2

PDB Entry: 1ojs (more details), 2.91 Å

PDB Description: 2.9 a resolution structure of malate dehydrogenase from archaeoglobus fulgidus in complex with nadh.
PDB Compounds: (A:) malate dehydrogenase

SCOP Domain Sequences for d1ojsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojsa2 d.162.1.1 (A:164-331) Lactate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
gnqldsqrlkerlynagarnirrawiigehgdsmfvaksladfdgevdweavendvrfva
aevikrkgatifgpavaiyrmvkavvedtgeiiptsmilqgeygienvavgvpaklgkng
aevadiklsdeeieklrnsakilrerleelgy

SCOP Domain Coordinates for d1ojsa2:

Click to download the PDB-style file with coordinates for d1ojsa2.
(The format of our PDB-style files is described here.)

Timeline for d1ojsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ojsa1