Lineage for d1ojsa1 (1ojs A:22-163)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 821465Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
  6. 821602Protein Malate dehydrogenase [51849] (12 species)
  7. 821607Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [110427] (2 PDB entries)
    Uniprot O08349
  8. 821609Domain d1ojsa1: 1ojs A:22-163 [103988]
    Other proteins in same PDB: d1ojsa2
    complexed with na, nad, so4

Details for d1ojsa1

PDB Entry: 1ojs (more details), 2.91 Å

PDB Description: 2.9 a resolution structure of malate dehydrogenase from archaeoglobus fulgidus in complex with nadh.
PDB Compounds: (A:) malate dehydrogenase

SCOP Domain Sequences for d1ojsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojsa1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
mklgfvgagrvgstsaftcllnldvdeialvdiaedlavgeamdlahaaagidkypkivg
gadysllkgseiivvtaglarkpgmtrldlahknagiikdiakkivenapeskilvvtnp
mdvmtyimwkesgkprnevfgm

SCOP Domain Coordinates for d1ojsa1:

Click to download the PDB-style file with coordinates for d1ojsa1.
(The format of our PDB-style files is described here.)

Timeline for d1ojsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ojsa2