Lineage for d1oiyb2 (1oiy B:310-432)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003386Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2003387Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2003388Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2003401Protein Cyclin A [47956] (2 species)
  7. 2003437Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries)
    Uniprot P20248 175-432
  8. 2003685Domain d1oiyb2: 1oiy B:310-432 [103966]
    Other proteins in same PDB: d1oiya1, d1oiya2, d1oiyc1, d1oiyc2
    complexed with mg, n41, sgm

Details for d1oiyb2

PDB Entry: 1oiy (more details), 2.4 Å

PDB Description: structure of human thr160-phospho cdk2/cyclin a complexed with a 6-cyclohexylmethyloxy-2-anilino-purine inhibitor
PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d1oiyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oiyb2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOPe Domain Coordinates for d1oiyb2:

Click to download the PDB-style file with coordinates for d1oiyb2.
(The format of our PDB-style files is described here.)

Timeline for d1oiyb2: