SCOPe 2.02: Domain d1oiya_: 1oiy A:

Lineage for d1oiya_ (1oiy A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88856] (223 PDB entries)
   Uniprot P24941

8. Domain d1oiya_: 1oiy A: [103964]
   Other proteins in same PDB: d1oiyb1, d1oiyb2, d1oiyd1, d1oiyd2
   complexed with mg, n41, sgm

Details for d1oiya_

PDB Entry: 1oiy, 2.4 Å

PDB Description: structure of human thr160-phospho cdk2/cyclin a complexed with a 6-cyclohexylmethyloxy-2-anilino-purine inhibitor

PDB Compounds: (A:) Cell division protein kinase 2

SCOPe Domain Sequences for d1oiya_:

Sequence, based on SEQRES records:

>d1oiya_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl

Sequence, based on observed residues (ATOM records):

>d1oiya_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
smenfqkvekigegtygvvykarnkltgevvalkkirltegvpstaireisllkelnhpn
ivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchshr
vlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyyst
avdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpk
warqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl

Timeline for d1oiya_:

• d1oiya_ first appeared in SCOP 1.69
  
• d1oiya_ appears in SCOPe 2.01
  
• d1oiya_ appears in SCOPe 2.03
  
• d1oiya_ appears in the current release, SCOPe 2.08, called d1oiya1