SCOP 1.73: Domain d1oiua_: 1oiu A:

Lineage for d1oiua_ (1oiu A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88856] (124 PDB entries)

8. Domain d1oiua_: 1oiu A: [103958]
   Other proteins in same PDB: d1oiub1, d1oiub2, d1oiud1, d1oiud2

Details for d1oiua_

PDB Entry: 1oiu, 2 Å

PDB Description: structure of human thr160-phospho cdk2/cyclin a complexed with a 6-cyclohexylmethyloxy-2-anilino-purine inhibitor

PDB Compounds: (A:) Cell division protein kinase 2

SCOP Domain Sequences for d1oiua_:

Sequence, based on SEQRES records:

>d1oiua_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
pgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllke
lnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglaf
chshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgc
kyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdyk
psfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

Sequence, based on observed residues (ATOM records):

>d1oiua_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
pgsmenfqkvekigegtygvvykarnkltgevvalkkirltegvpstaireisllkelnh
pnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchs
hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf
pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

Timeline for d1oiua_:

• d1oiua_ first appeared in SCOP 1.69
  
• d1oiua_ appears in SCOP 1.71
  
• d1oiua_ appears in SCOP 1.75
  
• d1oiua_ appears in the current release, SCOPe 2.08, called d1oiua1