Lineage for d1oiea1 (1oie A:363-550)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578514Fold d.114: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55815] (1 superfamily)
    core: alpha-beta(2)-alpha-beta(2)-alpha-beta; 3 layers; mixed sheet: order 31425
  4. 2578515Superfamily d.114.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55816] (2 families) (S)
  5. 2578516Family d.114.1.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55817] (1 protein)
  6. 2578517Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55818] (3 species)
  7. 2578518Species Escherichia coli [TaxId:562] [55819] (8 PDB entries)
    Uniprot P07024 26-550
  8. 2578531Domain d1oiea1: 1oie A:363-550 [103956]
    Other proteins in same PDB: d1oiea2, d1oiea3
    complexed with ni

Details for d1oiea1

PDB Entry: 1oie (more details), 2.33 Å

PDB Description: 5'-nucleotidase (e. coli) with an engineered disulfide bridge (s228c, p513c)
PDB Compounds: (A:) protein usha

SCOPe Domain Sequences for d1oiea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oiea1 d.114.1.1 (A:363-550) 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain {Escherichia coli [TaxId: 562]}
kigetngrlegdrdkvrfvqtnmgrlilaaqmdrtgadfavmsgggirdsieagdisykn
vlkvqpfgnvvvyadmtgkevidyltavaqmkpdsgaypqfanvsfvakdgklndlkikg
epvdpaktyrmatlnfnatggdgyprldnkcgyvntgfidaevlkayiqksspldvsvye
pkgevswq

SCOPe Domain Coordinates for d1oiea1:

Click to download the PDB-style file with coordinates for d1oiea1.
(The format of our PDB-style files is described here.)

Timeline for d1oiea1: