Lineage for d1oe3a2 (1oe3 A:160-336)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strandsSuperfamily b.6.1: Cupredoxins [49503] (6 families) 
contains copper-binding site
Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) Protein Nitrite reductase, NIR [49551] (5 species)
consists of two domains of this foldSpecies Alcaligenes xylosoxidans [TaxId:85698] [49554] (12 PDB entries) 
Domain d1oe3a2: 1oe3 A:160-336 [103904]
Details for d1oe3a2
PDB Entry: 1oe3 (more details), 1.15 Å
PDB Description: atomic resolution structure of 'half apo' nir
SCOP Domain Sequences for d1oe3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oe3a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans}
qgkplhydraytigefdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvg
altganaltakvgetvllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirg
gsagaalytfkqpgvyaylnhnlieafelgaaghikvegkwnddlmkqikapapipr
SCOP Domain Coordinates for d1oe3a2:
Click to download the PDB-style file with coordinates for d1oe3a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1oe3a2:
- d1oe3a2 is new in SCOP 1.69
- d1oe3a2 appears in SCOP 1.71
- d1oe3a2 appears in the current release, SCOPe 2.08
View in 3D
