SCOPe 2.04: Domain d1ob2a3: 1ob2 A:1-204

Lineage for d1ob2a3 (1ob2 A:1-204)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)

7. Species Escherichia coli [TaxId:562] [52627] (10 PDB entries)
   Uniprot P02990

8. Domain d1ob2a3: 1ob2 A:1-204 [103902]
   Other proteins in same PDB: d1ob2a1, d1ob2a2
   protein/RNA complex; complexed with gnp, kir, mg, suc

Details for d1ob2a3

PDB Entry: 1ob2, 3.35 Å

PDB Description: e. coli elongation factor ef-tu complexed with the antibiotic kirromycin, a gtp analog, and phe-trna

PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d1ob2a3:

Sequence; same for both SEQRES and ATOM records:

>d1ob2a3 c.37.1.8 (A:1-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]}
akekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargi
tintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehil
lgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkaleg
daeweakilelagfldsyipeper

Timeline for d1ob2a3:

• d1ob2a3 first appeared in SCOP 1.69
  
• d1ob2a3 appears in SCOPe 2.03
  
• d1ob2a3 appears in SCOPe 2.05
  
• d1ob2a3 appears in the current release, SCOPe 2.08