Lineage for d1ob2a1 (1ob2 A:205-296)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2062651Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2062652Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 2062736Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 2062743Species Escherichia coli [TaxId:562] [50450] (8 PDB entries)
    Uniprot P02990
  8. 2062757Domain d1ob2a1: 1ob2 A:205-296 [103900]
    Other proteins in same PDB: d1ob2a2, d1ob2a3
    protein/RNA complex; complexed with gnp, kir, mg, suc

Details for d1ob2a1

PDB Entry: 1ob2 (more details), 3.35 Å

PDB Description: e. coli elongation factor ef-tu complexed with the antibiotic kirromycin, a gtp analog, and phe-trna
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d1ob2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ob2a1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

SCOPe Domain Coordinates for d1ob2a1:

Click to download the PDB-style file with coordinates for d1ob2a1.
(The format of our PDB-style files is described here.)

Timeline for d1ob2a1: