Lineage for d1ob2a1 (1ob2 A:205-296)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 560964Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 560975Superfamily b.43.3: Translation proteins [50447] (3 families) (S)
  5. 560976Family b.43.3.1: Elongation factors [50448] (9 proteins)
  6. 561023Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 561030Species Escherichia coli [TaxId:562] [50450] (5 PDB entries)
  8. 561039Domain d1ob2a1: 1ob2 A:205-296 [103900]
    Other proteins in same PDB: d1ob2a2, d1ob2a3
    complexed with 2mg, 5mc, 7mg, gnp, h2u, kir, m2g, mad, mg, omc, omg, pha, psu, suc, yg

Details for d1ob2a1

PDB Entry: 1ob2 (more details), 3.35 Å

PDB Description: e. coli elongation factor ef-tu complexed with the antibiotic kirromycin, a gtp analog, and phe-trna

SCOP Domain Sequences for d1ob2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ob2a1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

SCOP Domain Coordinates for d1ob2a1:

Click to download the PDB-style file with coordinates for d1ob2a1.
(The format of our PDB-style files is described here.)

Timeline for d1ob2a1: