Lineage for d1o5dt1 (1o5d T:6-106)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657193Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 657194Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
    Pfam PF00041
  6. 657284Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 657285Species Human (Homo sapiens) [TaxId:9606] [49268] (10 PDB entries)
  8. 657292Domain d1o5dt1: 1o5d T:6-106 [103883]
    Other proteins in same PDB: d1o5dh_, d1o5dl1, d1o5dl2

Details for d1o5dt1

PDB Entry: 1o5d (more details), 2.05 Å

PDB Description: dissecting and designing inhibitor selectivity determinants at the s1 site using an artificial ala190 protease (ala190 upa)
PDB Compounds: (T:) tissue factor

SCOP Domain Sequences for d1o5dt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o5dt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpylet

SCOP Domain Coordinates for d1o5dt1:

Click to download the PDB-style file with coordinates for d1o5dt1.
(The format of our PDB-style files is described here.)

Timeline for d1o5dt1: