Lineage for d1nkqe_ (1nkq E:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2561549Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 2561550Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. 2561551Family d.177.1.1: FAH [56530] (7 proteins)
    automatically mapped to Pfam PF01557
  6. 2561593Protein Hypothetical protein Ynl168c [111272] (1 species)
  7. 2561594Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [111273] (1 PDB entry)
    Uniprot P53889
  8. 2561599Domain d1nkqe_: 1nkq E: [103866]
    Structural genomics target
    complexed with acy, ca, so4

Details for d1nkqe_

PDB Entry: 1nkq (more details), 2.2 Å

PDB Description: crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
PDB Compounds: (E:) Hypothetical 28.8 kDa protein in PSD1-SKO1 intergenic region

SCOPe Domain Sequences for d1nkqe_:

Sequence, based on SEQRES records: (download)

>d1nkqe_ d.177.1.1 (E:) Hypothetical protein Ynl168c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
synylkaarkiicigrnyaahikelnnstpkqpffflkptssivtplssslvkttrpans
tfnglnedgtnpgpifiprgvkvhheielalivskhlsnvtkmkpeevydsisgvalald
ltarnvqdeakkkglpwtiskgfdtfmpisaivsrekfssyksnlqdifrvkcsvngqlr
qdggtnlmlhplhkilqhistmislepgdiiltgtpagvgelkpgdrvhcellqnndniv
dmnfecenrpgpyefr

Sequence, based on observed residues (ATOM records): (download)

>d1nkqe_ d.177.1.1 (E:) Hypothetical protein Ynl168c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
synylkaarkiicigrnyaahikelnnqpffflkptssivtplssspanstfnglnedgt
npgpifiprgvkvhheielalivskhlsnvtkmkpeevydsisgvalaldltarnvqdea
kkkglpwtiskgfdtfmpisaivsrekfssyksnlqdifrvkcsvngqlrqdggtnlmlh
plhkilqhistmislepgdiiltgtpagvgelkpgdrvhcellqnndnivdmnfecenrp
gpyefr

SCOPe Domain Coordinates for d1nkqe_:

Click to download the PDB-style file with coordinates for d1nkqe_.
(The format of our PDB-style files is described here.)

Timeline for d1nkqe_: