SCOPe 2.06: Domain d1n70a1: 1n70 A:41-193

Lineage for d1n70a1 (1n70 A:41-193)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Rhodobacter sphaeroides [TaxId:1063] [110101] (8 PDB entries)
   Uniprot Q53239

8. Domain d1n70a1: 1n70 A:41-193 [103856]
   complexed with cu, mg; mutant

Details for d1n70a1

PDB Entry: 1n70, 1.6 Å

PDB Description: the crystal structure of nitrite reductase mutant his287ala from rhodobacter sphaeroides

PDB Compounds: (A:) Copper-containing nitrite reductase precursor

SCOPe Domain Sequences for d1n70a1:

Sequence; same for both SEQRES and ATOM records:

>d1n70a1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]}
lsnlprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsip
gplmivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatra
gafvyhcapggpmipwhvvsgmagcimvlprdg

Timeline for d1n70a1:

• d1n70a1 first appeared in SCOP 1.69
  
• d1n70a1 appears in SCOPe 2.05
  
• d1n70a1 appears in SCOPe 2.07
  
• d1n70a1 appears in the current release, SCOPe 2.08