SCOP 1.71: Domain d1mzzc1: 1mzz C:2041-2193

Lineage for d1mzzc1 (1mzz C:2041-2193)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (6 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Rhodobacter sphaeroides [TaxId:1063] [110101] (3 PDB entries)

8. Domain d1mzzc1: 1mzz C:2041-2193 [103854]

Details for d1mzzc1

PDB Entry: 1mzz, 2 Å

PDB Description: crystal structure of mutant (m182t)of nitrite reductase

SCOP Domain Sequences for d1mzzc1:

Sequence; same for both SEQRES and ATOM records:

>d1mzzc1 b.6.1.3 (C:2041-2193) Nitrite reductase, NIR {Rhodobacter sphaeroides}
lsnlprvkhtlvpppfahaheqvaasgpvinefemriiekevqldedaylqamtfdgsip
gplmivhegdyveltlinppentmphnidfhaatgalggggltlinpgekvvlrfkatra
gafvyhcapggpmipwhvvsgtagcimvlprdg

Timeline for d1mzzc1:

• d1mzzc1 first appeared in SCOP 1.69
  
• d1mzzc1 appears in SCOP 1.73
  
• d1mzzc1 appears in the current release, SCOPe 2.08