Class b: All beta proteins [48724] (177 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
Species Rhodobacter sphaeroides [TaxId:1063] [110101] (8 PDB entries) Uniprot Q53239 |
Domain d1mzza2: 1mzz A:194-371 [103851] Other proteins in same PDB: d1mzza3, d1mzzb3, d1mzzc3 complexed with cu; mutant |
PDB Entry: 1mzz (more details), 2 Å
SCOPe Domain Sequences for d1mzza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mzza2 b.6.1.3 (A:194-371) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} lkdhegkpvrydtvyyigesdhyipkdedgtymrfsdpsegyedmvavmdtlipshivfn gavgaltgegalkakvgdnvlfvhsqpnrdsrphligghgdlvwetgkfhnaperdletw firggtagaalykflqpgvyayvnhnlieavhkgatahvlvegewdndlmeqvvapvg
Timeline for d1mzza2: